PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.001G069700.2
Common NameB456_001G069700, LOC105787310
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB_related
Protein Properties Length: 458aa    MW: 50842.7 Da    PI: 8.1066
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.001G069700.2genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding537.7e-175498147
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
     Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                        r +WT+eE+e++++a +++G g W+ I +++g ++++ q++s+ qk+
  Gorai.001G069700.2 54 REKWTEEEHERFLEALRLYGRG-WRQIEEHVG-TKSAVQIRSHAQKF 98
                        789*******************.*********.************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466895.83E-1648102IPR009057Homeodomain-like
PROSITE profilePS5129421.31749103IPR017930Myb domain
TIGRFAMsTIGR015574.7E-1652101IPR006447Myb domain, plants
SMARTSM007171.5E-1253101IPR001005SANT/Myb domain
PfamPF002491.7E-145497IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.0E-85494IPR009057Homeodomain-like
CDDcd001671.15E-105699No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 458 aa     Download sequence    Send to blast
MDTQDQIEDK TSPNAFKSGI CPQSKTLNQL QELYTFNHDH TPKARKPYTI TKQREKWTEE  60
EHERFLEALR LYGRGWRQIE EHVGTKSAVQ IRSHAQKFFS KVVRESNGGF DGSIKPIVIP  120
PPRPKRKPVH PYPRKSVDLV KGKSPSSQPE RSPSPNQFFR EQDNKSPTSV LSDAMGSSAL  180
EQQKGCSSPT SCTTNLQSIN TSPVEKETDY ATSNLAAEEE KRSLSSVKIF GQSDAENILS  240
MNLNADFKDF VFGEGNAAPV IPSTSIKLFG KTVQVKDSPK PSISAENFES QTSKTSRDDV  300
DAVNKMLVQA FPSTHLDTSL SHGTVIDNWN AMPSRANLST SDAPLPWWAF YQGVPFCYIT  360
SFNQNRSDSS VGERMKEKEI LNEGSCSGSN TGSVSHVSRR VSDCIDSESQ HPCLEGKMSP  420
QRCTKGFVPY KRCLAERDMT SSVVSEGQET HRARVCS*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012469140.10.0PREDICTED: protein REVEILLE 7-like isoform X1
RefseqXP_012469145.10.0PREDICTED: protein REVEILLE 7-like isoform X1
RefseqXP_012469149.10.0PREDICTED: protein REVEILLE 7-like isoform X1
SwissprotB3H5A81e-54RVE7_ARATH; Protein REVEILLE 7
TrEMBLA0A0D2QLN30.0A0A0D2QLN3_G
STRINGPOPTR_0012s03530.11e-123(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G18330.13e-42MYB_related family protein
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]